Recombinant Human PMP2 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP01086-10, RP01086-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PMP2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Val132) of human PMP2 (Accession #P02689) fused with a 6×His tag at the N-terminus.
Alternate Names: PMP2, FABP8, M-FABP, MP2, P2
SWISS: P02689
GeneID: 5375
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
Source: E. coli
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.
Antigen Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only