Recombinant Human Renin/REN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01175-10, RP01175-20, RP01175-50, RP01175-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Renin/REN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Arg406) of human Renin (Accession #NP_000528.1.) fused with a 8×His tag at the C-terminus.
Alternate Names: REN, Renin, Angiotensinogenase
SWISS: P00797
GeneID: 5972
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human REN Protein at 0.5 μg/mL (100 μL/well) can bind Renin Rabbit pAb with a linear range of 1.9-302.7 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only