Recombinant Human S100-A8 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01629LQ-10, RP01629LQ-20, RP01629LQ-50, RP01629LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human S100-A8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu93) of human S100-A8 (Accession #NP_002955.2) fused with a Flag tag at the C-terminus.
Alternate Names: 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8, S100A8, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
SWISS: P05109
GeneID: 6279
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Tag: C-Flag
Formulation: Supplied as a 0.22 μm filtered solution in 50mM Tris, 500mM NaCl, 5mM MgSO4 and 5% glycerol, pH8.0
Antigen Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only