Recombinant Human Serpin B3/SCCA-1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01110-10, RP01110-20, RP01110-50, RP01110-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Serpin B3/SCCA-1 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met1-Pro390) of human Serpin B3 (Accession #P29508) fused with a 6×His tag at the C-terminus.
Alternate Names: SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3, SerpinB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3
SWISS: P29508
GeneID: 6317
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Serpin B3, also known as squamous cell carcinoma antigen-1 (SCCA-1), is a member of the serpin superfamily of serine protease inhibitors. Serpin B3 belongs to the subgroup ovalbumin-related serpins which are involved in the regulation of apoptosis, inflammation, angiogenesis and embryogenesis. It may act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. It also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only