WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Serum amyloid A-1/SAA1 Protein - RP01095

Recombinant Human Serum amyloid A-1/SAA1 Protein - RP01095

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Serum amyloid A-1/SAA1 Protein Sizes: 10ug, 50ug Catalogue Number: RP01095-10, RP01095-50 Citations, Manuals and MSDS Available upon request. Description: Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6×His tag at the N-terminus. Alternate Names: SAA1, PIG4, SAA, SAA2, TP53I4 SWISS: P0DJI8 GeneID: 6288 Species: Human Purity: ≥ 95 % as determined by SDS-PAGE. Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week. Background: This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer' s disease and Crohn' s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. Source: E. coli Tag: N-His Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.Contact us for customized product form or formulation. Antigen Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY Endotoxin: < 1 EU/μg of the protein by LAL method. Research Use Only