WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human SLAMF1/CD150 Protein - RP00510

Recombinant Human SLAMF1/CD150 Protein - RP00510

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human SLAMF1/CD150 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00510-10, RP00510-20, RP00510-50, RP00510-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD150/SLAM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Pro237) of human CD150/SLAM (Accession #Q13291) fused with a hFC tag at the C-terminus.

Alternate Names: SLAMF1, CD150, CDw150, SLAM

SWISS: Q13291

GeneID: 6504

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes ofSLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another inwhich protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only