Recombinant Human SLAMF4/2B4/CD244 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00167-20, RP00167-50, RP00167-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human SLAMF4/2B4/CD244 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys22-Arg221) of human 2B4/SLAMF/CD244 (Accession #NP_057466.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD244, 2B4, NAIL, NKR2B4, Nmrk, SLAMF4
SWISS: Q9BZW8
GeneID: 51744
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cluster of differentiation 24, also known as signal transducer CD24 or heat stable antigen CD24 (HSA), is a mucin-type glycosylphosphatidylinositol-linked glycoprotein expressed on the surface of B-cells, differentiating neuroblasts and many tumors. It is involved in molecular adhesion and metastatic tumor spread and serve as a normal receptor for P-selectin. The CD24 / P-selectin pathway could be important in dissimenating of tumor cells by facilitating the interaction with platelet and endothelial cells. It has also been considered as a tumor marker. High rate of CD24 expressions have been found in epithelial ovarian cancer, breast cancer, non-small cell lung cancer, prostate cancer and pancreatic cancer.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant human CD48 at 5 μg/mL (100 μL/well) can bind recombinant human CD244 with a linear range of 0.2-1 μg/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only