Recombinant Human Thioredoxin/SASP/TXN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00036-10, RP00036-20, RP00036-50, RP00036-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Thioredoxin/SASP/TXN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Val105) of human Thioredoxin (Accession #NP_003320.2) fused with a 6×His tag at the C-terminus.
Alternate Names: TRDX, TRX, TRX1, TXN, TRX, TRX1
SWISS: P10599
GeneID: 7295
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Thioredoxin, also known as ATL-derived factor, Surface-associated sulphydryl protein, SASP and TXN, is a nucleus, cytoplasm and secreted protein which belongs to the thioredoxin family. Trx-1 is the only extracellular occurring thioredoxin, and is secreted by lymphocytes, hepatocytes, fibroblasts, and several tumor cells. Plasma concentrations of Trx-1 are up to 6 nM. In cells, Trx-1 is localized predominantly in the cytoplasm. Small amounts have been detected in the nucleus and in association with the outside surface of the cells. Biological functions of Trx-1 include growth factor activity, antioxidant properties, a cofactor that provides reducing equivalents, and transcriptional regulation.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TXN Protein at 1 μg/mL (100 μL/well) can bind TXN Rabbit mAb with a linear range of 0.976-5.3 ng/mL.|2.Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is >9 A650/min/mg.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only