Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02082-10, RP02082-20, RP02082-50, RP02082-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Ala109-Asn239) of Human TRAIL R1 / DR4 / TNFRSF10A fused with His tag at the C-terminal.
Alternate Names: TNFRSF10A, APO2, CD261, DR4, TRAILR-1, TRAILR1
SWISS: O00220
GeneID: 8797
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A) is also known as TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1), Death receptor 4 (DR4), CD261 and APO2, which belongs to TNF superfamily.The expression of apoptosis-inducing TRAIL-R1 and TRAIL-R2 and of the decoy receptors TRAIL-R3 and TRAIL-R4 was systematically studied in all developmental stages of peripheral B cells isolated from the blood and secondary lymphoid organs. Expression of TRAIL-Rs is modulated along development, with highest levels observed in germinal center B cells.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only