Recombinant Human TNFRSF18/GITR/CD357 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01399-10, RP01399-20, RP01399-50, RP01399-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF18/GITR/CD357 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Glu161) of human GITR/TNFRSF18 (Accession #NP_004186.1.) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: TNFRSF18, AITR, CD357, GITR, GITR-D
SWISS: Q9Y5U5-1
GeneID: 8784
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: GITR, also known as TNFRSF18(CD357), belongs to the tumor necrosis factor receptor (TNF-R) superfamily. It is the receptor for TNFSF18. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. GITR may be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. GITR and its ligand are important costimulatory molecules in the pathogenesis of autoimmune diseases. It also mediates NF-kappa-B activation via the TRAF2/NIK pathway.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human TNFSF18 at 10 μg/mL (100 μL/well) can bind Human TNFRSF18 with a linear range of 0.8-14.5 μg/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only