Recombinant Human TNFRSF6/FAS/CD95 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP00139-10, RP00139-50, RP00139-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF6/FAS/CD95 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Asn173) of human FAS/CD95/APO-1/TNFRSF6 (Accession #NP_000034.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6, FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6, Fas cell surface death receptor
SWISS: P25445
GeneID: 355
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized recombinant Human Fas Ligand at 2 μg/mL (100 μL/well) can bind recombinant Human FAS. The EC50 of Human FAS is 6.23 ng/mL.|2.Measured by its ability to inhibit Fas Ligand-induced apoptosis of Jurkat Human acute T cell leukemia cells. The ED50 for this effect is typically 16.5-66 ng/mL in the presence of 5 ng/mL Recombinant Human Fas Ligand.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only