Recombinant Human TNFRSF8/CD30 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00106-10, RP00106-20, RP00106-50, RP00106-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TNFRSF8/CD30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of human CD30/TNFRSF8 (Accession #NP_001234.2) fused with a 6×His tag at the C-terminus.
Alternate Names: CD30, D1S166E, Ki-1, TNFRSF8, CD30, TNF receptor superfamily member 8, D1S166E, Ki-1
SWISS: P28908
GeneID: 943
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human CD30/TNFRSF8 at 2 μg/mL (100 μL/well) can bind recombinant Human CD30L with a linear range of 1.22-15.23 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only