WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFSF6/FAS ligand/CD178 Protein - RP02353

Recombinant Human TNFSF6/FAS ligand/CD178 Protein - RP02353

Regular price
$252.00
Regular price
Sale price
$252.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFSF6/FAS ligand/CD178 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP02353-20, RP02353-50, RP02353-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF6/FAS ligand/CD178 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Pro134-Leu281) of Human Fas Ligand(monomer) fused with a His tag at the N-terminal.

Alternate Names: FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A, Fas ligand, FasL, FasLG

SWISS: P48023

GeneID: 356

Species: Human

Purity: ≥ 95 % as determined by Tris-Bis PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to induce apoptosis of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 2.075-8.3 ng/mL in the presence of 10 µg/mL of a cross-linking antibody Rabbit Anti-poly Histidine Monoclonal Antibody (Catalog # AE086), corresponding to a specific activity of 1.20×10^5 ~4.82×10^5 units/mg.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only