WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human TNFSF9/4-1BB Ligand Protein - RP00060

Recombinant Human TNFSF9/4-1BB Ligand Protein - RP00060

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human TNFSF9/4-1BB Ligand Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00060-10, RP00060-20, RP00060-50, RP00060-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human TNFSF9/4-1BB Ligand Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg71-Glu254) of human 4-1BB Ligand/TNFSF9 (Accession #NP_003802.1) fused with a 6×His tag at the C-terminus.

Alternate Names: 4-1BB-L, CD137L, TNLG5A, TNFSF9, CD137L, TNLG5A

SWISS: P41273

GeneID: 8744

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized recombinant human TNFSF9 at 2 μg/mL (100 μL/well) can bind recombinant human TNFRSF9 with a linear range of 40-100 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF9/4-1BB at 2 μg/mL (100 μL/well) can bind Human TNFRSF9/4-1BB/CD137 with a linear range of 0.1-5.8 ng/mL.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only