Recombinant Human TROP-2/TACSTD2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01048-10, RP01048-20, RP01048-50, RP01048-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr88-Thr274) of human TROP-2 (Accession #NP_002344.2) fused with a 6×His tag at the C-terminus.
Alternate Names: TACSTD2, EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2
SWISS: P09758-1
GeneID: 4070
Species: Human
Purity: ≥ 85% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TACSTD2 (Catalog: RP01048) at 1 μg/mL (100 μL/well) can bind TROP-2 Rabbit mAb (Catalog: A24170) with a linear range of 0.128-0.85 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only