Recombinant Human TSLP(R127A,R130A) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01172-10, RP01172-20, RP01172-50, RP01172-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TSLP(R127A,R130A) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr29-Gln159(Arg127Ala, Arg130Ala)) of human TSLP (Accession #NP_149024.1) fused with a 6×His tag at the C-terminus.
Alternate Names: TSLP
SWISS: Q969D9-1
GeneID: 85480
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TSLP at 2 μg/mL (100 μL/well) can bind Recombinant Human TSLPR with a linear range of 20-90 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only