Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP10041LQ-20, RP10041LQ-50, RP10041LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser2-Thr193) of Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 (Accession # P51965) fused with No tag.
Alternate Names: UBE2E1, UBCH6, Ubiquitin-conjugating enzyme E2 E1
SWISS: P51965
GeneID: 7324
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Ube2E1 is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for ubiquitination of protein substrates. Ube2E1 was found to locate in the nucleus. It, along with Ube2D1, is known to complex with the E3 ligase Ro52 to ubiquitinate interferon regulatory transcription factors IRF3 and IRF8. Ube2E1 can also complex with a Ub ligase called RING105 to ubiquitinate a tumor suppressor known as tumor – suppressing subchromosomal transferable fragment cDNA (TSSC5).
Source: E. coli
Tag: NO-Tag
Formulation: 0.22 μm filtered solution of 50 mM HEPES pH 7.5, 200 mM NaCl, 10% Glycerol (v/v), 1 mM TCEP.
Antigen Sequence: SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only