Recombinant Human uPAR/PLAUR/CD87 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00295-10, RP00295-20, RP00295-50, RP00295-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Arg303) of human uPAR (Accession #NP_002650.1) fused with a 6×His tag at the C-terminus.
Alternate Names: PLAUR, CD87, U-PAR, UPAR, URKR, plasminogen activator, urokinase receptor, CD87, U-PAR, UPAR, URKR
SWISS: Q03405
GeneID: 5329
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The secreted recombinant human UPAR consists of 292 amino acids with a molecular weight of 32.8 kDa. Recombinant human UPAR migrates as an about 48 kDa band in SDS-PAGE under reducing conditions due to glycosylation.Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87. U-PAR contains three UPAR/Ly6 domains and is expressed in neurons of the rolandic area of the brain (at protein level). PLAUR / UPAR acts as a receptor for urokinase plasminogen activator and plays a role in localizing and promoting plasmin formation. Urokinase plasminogen activator (uPA) and/or its receptor (uPAR) are essential for metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumours. Furthermore, the analysis of U-PAR expression has a potential role in the diagnostic or prognostic work-up of several hematological malignancies, particularly acute leukemia and multiple myeloma.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human PLAUR at 1 μg/mL (100 μL/well) can bind PLAUR Rabbit pAb with a linear range of 0.03-14.17ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only