WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human VSIG4 Protein - RP00286

Recombinant Human VSIG4 Protein - RP00286

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human VSIG4 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00286-20, RP00286-50, RP00286-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human VSIG4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg20-Pro283) of human VSIG4 (Accession #NP_009199.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: CRIg, Z39IG, VSIG4, VSIG4, CRIg, Z39IG, VSIG4

SWISS: Q9Y279-1

GeneID: 11326

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only