Recombinant Human VSIG4 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00286-20, RP00286-50, RP00286-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human VSIG4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg20-Pro283) of human VSIG4 (Accession #NP_009199.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CRIg, Z39IG, VSIG4, VSIG4, CRIg, Z39IG, VSIG4
SWISS: Q9Y279-1
GeneID: 11326
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only