Recombinant Human WIF-1(Q166K) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00190-10, RP00190-20, RP00190-50, RP00190-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human WIF-1(Q166K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly29-Trp379(Gln166Lys)) of human WIF-1 (Accession #NP_009122.2) fused with a 6×His tag at the C-terminus.
Alternate Names: WIF-1, WIF1
SWISS: Q9Y5W5
GeneID: 11197
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: WIF (Wnt Inhibitory Factor) is a secreted protein that binds to Wnt proteins and inhibits their activity. WIF is extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation.. WIF-1 is implicated as an early event tumor suppressor in cancers of the prostate, breast, lung and bladder. However, WIF-1’s role in carcinogenesis may not be that simple since in other cancer types, such as colon adenocarcinoma, WIF facilitates tumorigenesis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM HAc-NaAc,150mM NaCl,0.5% CHAPS, pH 6.0.Contact us for customized product form or formulation.
Antigen Sequence: GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only