WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Monkeypox virus A29 Protein - RP01543

Recombinant Monkeypox virus A29 Protein - RP01543

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Monkeypox virus A29 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01543-20, RP01543-50, RP01543-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Monkeypox virus A29 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu110) of A29 (Accession #URK20577.1) fused with a 6×His tag at the C-terminus.

Alternate Names: A29L, A29, A29L, A29L, A29, A29L

SWISS: Q77HM6

GeneID: 928966

Species: Monkeypox virus

Purity: ≥ 85 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only