WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Monkeypox virus D6L Protein - RP01606

Recombinant Monkeypox virus D6L Protein - RP01606

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Monkeypox virus D6L Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01606-10, RP01606-20, RP01606-50, RP01606-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Monkeypox virus D6L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val21-Lys126) of monkeypox virus D6L (Accession #Q5QC89) fused with a 6×His tag at the C-terminus.

Alternate Names: IL-18 binding protein; COP-009; D6L

SWISS: Q5QC89

GeneID: 929030

Species: Monkeypox virus

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only