Recombinant Monkeypox virus L1R Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01544-10, RP01544-20, RP01544-50, RP01544-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Monkeypox virus L1R Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys152) of L1R (Accession #URK20522.1) fused with a 6×His tag at the C-terminus.
Alternate Names: L1R, L1R
SWISS: Q8V4Z7
GeneID: 928938
Species: Monkeypox virus
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only