WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse ALK-4/ACVR1B Protein - RP01803

Recombinant Mouse ALK-4/ACVR1B Protein - RP01803

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse ALK-4/ACVR1B Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01803-10, RP01803-20, RP01803-50, RP01803-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu126) of mouse ALK-4/ACVR1B (Accession #NP_031421.1) fused with hFC tag at the C-terminus.

Alternate Names: Alk4; SKR2; ALK-4; ActRIB; ActR-IB; Acvrlk4; 6820432J04

SWISS: Q61271

GeneID: 11479

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: ACVR1B (Activin A Receptor, type 1B), belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, and TGFB receptor subfamily. ALK-4/ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B. The known type II activin receptors include ActRII and ActRIIB, while the main type I activin receptor in mammalian cells is ALK-4 (ActRIB). In the presence of activin, type II and type I receptors form complexes whereby the type II receptors activate ALK-4 through phosphorylation. The activated ALK-4, in turn, transduces signals downstream by phosphorylation of its effectors, such as Smads, to regulate gene expression and affect cellular phenotype. ALK-4/ACVR1B is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse TDGF1 (Catalog: RP01946) at 5 μg/mL (100 μL/well) can bind Mouse ALK4(Catalog: RP01803) with a linear range of 4.5-133.2 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVE

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only