WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein - RP01743

Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein - RP01743

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01743-10, RP01743-20, RP01743-50, RP01743-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of mouse Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_033770.2) fused with a 6×His tag at the C-terminus.

Alternate Names: Ang1; Ang-1; 1110046O21Rik

SWISS: O08538

GeneID: 11600

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The angiopoietin (ANGPT)-TIE2/TEK signaling pathway is essential for blood and lymphatic vascular homeostasis. ANGPT1 is a potent TIE2 activator, whereas ANGPT2 functions as a context-dependent agonist/antagonist. In disease, ANGPT2-mediated inhibition of TIE2 in blood vessels is linked to vascular leak, inflammation, and metastasis.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only