WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein - RP01744

Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein - RP01744

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01744-10, RP01744-20, RP01744-50, RP01744-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys275-Phe496) of mouse Angiopoietin-2/ANG-2/ANGPT2 (Accession #NP_031452.2) fused with a 6×His tag at the C-terminus.

Alternate Names: Ang2; Agpt2; Ang-2

SWISS: O35608

GeneID: 11601

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only