WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse B7-2/CD86 Protein - RP01234

Recombinant Mouse B7-2/CD86 Protein - RP01234

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse B7-2/CD86 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01234-10, RP01234-20, RP01234-50, RP01234-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse B7-2/CD86 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Glu245) of mouse CD86/B7-2 (Accession #NP_062261.3) fused with a 6×His tag at the C-terminus.

Alternate Names: CD86, B7-2, B70, CD28LG2, LAB72, MGC34413, CD86, CD86, B7-2, B70, CD28LG2, LAB72, MGC34413, CD86

SWISS: P42082

GeneID: 12524

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD86, also known as B-lymphocyte activation antigen B7-2 (referred to as B70), is a member of the cell surface immunoglobulin superfamily. CD86 is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse CD86 at 2 μg/mL (100 μL/well) can bind Recombinant Human CTLA-4 with a linear range of 8-35 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only