Recombinant Mouse B7-H3/CD276 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01674-10, RP01674-20, RP01674-50, RP01674-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val 29 - Phe 244) of mouse CD276 (Accession #NP_598744.1) fused with and a hFc tag at the C-terminus.
Alternate Names: B7h3; B7RP-2; 6030411F23Rik; CD276
SWISS: Q8VE98
GeneID: 102657
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: B7-H3 is a member of the B7 family of immune regulatory ligands that is thought to attenuate peripheral immune responses through co-inhibition. It plays an important role in adaptive immune responses, and was shown to either promote or inhibit T-cell responses in various experimental systems. B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is a novel protein structurally related to the B7 family of ligands by the presence of a single set of immunoglobulin-V-like and immunoglobulin-C-like (VC) domains. Previous studies have correlated its overexpression with poor prognosis and decreased tumor-infiltrating lymphocytes in various carcinomas including uterine endometrioid carcinomas, and mounting evidence supports an immuno-inhibitory role in ovarian cancer prognosis. Recently, B7-H3 expression has been reported in several human cancers indicating an additional function of B7-H3 as a regulator of antitumor immunity.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse CD276 (Catalog: RP01674) at 2 μg/mL (100 μL/well) can bind CD276 Rabbit pAb (Catalog: A21663) with a linear range of 1-77.4 ng/mL.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only