WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse B7-H5/Gi24/VISTA Protein - RP01328

Recombinant Mouse B7-H5/Gi24/VISTA Protein - RP01328

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse B7-H5/Gi24/VISTA Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01328-10, RP01328-20, RP01328-50, RP01328-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse B7-H5/Gi24/VISTA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe33 - Ala191) of Mouse VISTA (Accession #NP_083008.1) fused with an 6×His tag at the C-terminus.

Alternate Names: B7-H5, Gi24, VISTA, SISP1, VISTA

SWISS: Q9D659

GeneID: 74048

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: VSIR, V-Set Immunoregulatory Receptor, also known as VISTA, is an immunoregulatory receptor that inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. VSIR, or V-set immunoregulatory receptor, could be involved in the pathogenesis of chronic rhinosinusitis with nasal polyps. V-domain Immunoglobulin Suppressor of T cell Activation (VISTA) is an inhibitory immune-checkpoint molecule that suppresses CD4+ and CD8+ T cell activation when expressed on antigen-presenting cells. VSIR is broadly expressed in the spleen, bone marrow, and other tissues. Diseases associated with VSIR include Ichthyosis, Congenital, Autosomal Recessive 6, and Monckeberg Arteriosclerosis.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse B7-H5/VISTA (Catalog: RP01328) at 0.5 μg/mL (100 μL/well) can bind B7-H5/VISTA Rabbit pAb with a linear range of 0.01-2.6 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNF TLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKN HHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only