Recombinant Mouse BY55/CD160 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01573-10, RP01573-20, RP01573-50, RP01573-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse BY55/CD160 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Ser160) of mouse BY55/CD160 (Accession #NP_061237.3) fused with a 6×His tag at the C-terminus.
Alternate Names: CD160 Antigen, Natural Killer Cell Receptor BY55, CD160, BY55, CD160
SWISS: O88875
GeneID: 54215
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only