WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse C7orf50(Cholesin) Protein - RP01980

Recombinant Mouse C7orf50(Cholesin) Protein - RP01980

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse C7orf50(Cholesin) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01980-10, RP01980-20, RP01980-50, RP01980-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse C7orf50(Cholesin) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser195) of Mouse 3110082I17Rik(Cholesin) (Accession #NP_082745.2) fused with His at the C-terminus.

Alternate Names: C7orf50, 3110082I17Rik, Cholesin, Protein C7orf50

SWISS: Q9CXL3

GeneID: 73212

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Hormone secreted from the intestine in response to cholesterol, where it acts to inhibit cholesterol synthesis in the liver and VLDL secretion,leading to a reduction in circulating cholesterol levels. Acts through binding to its receptor, GPR146.

Source: E. coli

Tag: C-6His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MAKHKRKGLEGTGKESKRQKITPAEETPRTSEAGPDKETASTLVQEASPELSPEERRVLERKLKKERKKEEKKRLREAGIAATQTAKVQTLPAKPSAATLALEYLQGWAQKQESWRFQKTRQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKAEALMQKLDEAEPEDSGGSPGKVQRLRQVLQLLS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only