Recombinant Mouse CD55 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP03522-10, RP03522-20, RP03522-50, RP03522-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CD55 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Asp35-Gly362) of Mouse CD55(Accession #NP_034146.2) fused with His tag at the C-Terminus.
Alternate Names: Cd55, Cd55a, Daf, Daf1, Complement decay-accelerating factor, GPI-anchored, DAF-GPI, CD55
SWISS: Q61475
GeneID: 13136
Species: Mouse
Purity: ≥ 90% as determined by reducing SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Recombinant Mouse CD55 Protein is a major regulator of the alternative and classical pathways of complement activation and is expressed on all serum-exposed cells.This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNTG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only