Recombinant Mouse CD83 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01555-10, RP01555-20, RP01555-50, RP01555-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CD83 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met22-Ala134) of mouse CD83 (Accession #NP_033986.1) fused with a 6×His tag at the C-terminus.
Alternate Names: BL11, HB15, CD83
SWISS: O88324
GeneID: 12522
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Mouse CD83 is a 30-35 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins.CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20 mM tris,200 mM Nacl,pH 8.0
Antigen Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only