Recombinant Mouse Complement C3 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01415-50, RP01415-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Complement C3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser671-Arg748) of mouse Complement component 3 (Accession #NP_033908.2) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: C3, AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p, complement C3, C3 / C3a
SWISS: P01027-1
GeneID: 12266
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: C3 is the major complement component serum. It is mainly synthesized by macrophages and liver. C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. It is cleaved into two fragments, C3a and C3b. C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only