Recombinant Mouse Cripto/TDGF1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01946-10, RP01946-20, RP01946-50, RP01946-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Cripto/TDGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg26-Gln150) of Mouse Cripto/TDGF1(Accession #NP_035692.2) fused with a His tag at the C-terminus.
Alternate Names: Cripto, Tdgf1, Teratocarcinoma-derived growth factor, Cripto growth factor, Epidermal growth factor-like Cripto protein
SWISS: P51865
GeneID: 21667
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only