WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse CSF-1/M-CSF Protein - RP01216

Recombinant Mouse CSF-1/M-CSF Protein - RP01216

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse CSF-1/M-CSF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01216-10, RP01216-20, RP01216-50, RP01216-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu262) of mouse M-CSF/CSF-1 (Accession #NP_031804.3.) fused with a 6×His tag at the C-terminus.

Alternate Names: MCSF, M-CSF, CSF-1, Lanimostim, CSF1

SWISS: P07141-1

GeneID: 12977

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte / macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.

Bio-Activity: 1.Measured in a cell proliferation assay using mouse bone marrow cells. The ED50 for this effect is 7.5-30.1 ng/mL, corresponding to a specific activity of 3.32×10^4 ~1.33×10^5 units/mg.| 2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells.The ED50 for this effect is 8.31-33.24 ng/mL, corresponding to a specific activity of 3.01×10^4 ~1.20×10^5 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Endotoxin: < 0.01 EU/μg of the protein by LAL method.

Research Use Only