Recombinant Mouse CSF-1/M-CSF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01216S-10, RP01216S-20, RP01216S-50, RP01216S-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Pro187) of Mouse CSF-1/M-CSF (Accession #NP_031804.3.) fused with No-tag.
Alternate Names: MCSF, M-CSF, CSF-1, Lanimostim, CSF1
SWISS: P07141-1
GeneID: 12977
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte / macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It
Bio-Activity: Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 3.76-15.16 ng/mL, corresponding to a specific activity of 6.6×10^4 ~2.65×10^5 units/mg.
Source: HEK293 cells
Tag: No-Tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only