WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse CXCL12/SDF-1 Protein - RP01877

Recombinant Mouse CXCL12/SDF-1 Protein - RP01877

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse CXCL12/SDF-1 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01877-10, RP01877-20, RP01877-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CXCL12/SDF-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys22-Lys89) of mouse CXCL12/SDF-1 alpha (Accession #P40224) fused with no tag.

Alternate Names: Cxcl12; Stromal cell-derived factor 1; SDF-1; 12-O-tetradecanoylphorbol 13-acetate repressedprotein 1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymiclymphoma cell-stimulating factor; TLSF; Sdf1

SWISS: P40224-1

GeneID: 20315

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Mouse Cxcl12 is a secreted and highly conserved protein which belongs to the intercrine alpha (chemokine CxC)family.CXCL12 is widely expressed in various organs including brain, kidney, skeletal muscle, heart, liver, and lymphoidorgans. Cxcl12 activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level ofintracellular calcium ions and chemotaxis. It also binds to atypical chemokine receptor ACKR3 which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Cxcl12 has several critical functions during embryonicdevelopment such as B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Cxcl12plays an important role in acting as a positive regulator of monocyte migration and a negative regulator of monocyteadhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 andACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. It also plays aprotective role after myocardial infarction, induces down-regulation and internalization of ACKR3 expressed in various cellsand stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of thestromal cell-dependent B-cell clone DW34 cells.

Bio-Activity: Measured by its ability to chemoattract MOLT4 cells. The ED50 for this effect is 8.49-33.94 ng/mL, corresponding to a specific activity of 2.95×10^4 ~1.18×10^5 units/mg.

Source: Pichia

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only