Recombinant Mouse Ephrin-A2/EFNA2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01515-10, RP01515-20, RP01515-50, RP01515-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Ephrin-A2/EFNA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg21-Asn184) of mouse Ephrin-A2 (Accession #NP_031935.3) fused with a 6×His tag at the C-terminus.
Alternate Names: Elf1, Epl6, CEK7L, Eplg6, Lerk6, EFNA2
SWISS: P52801
GeneID: 13637
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Ephrin-A2 also known as EFNA2 or EPH-related receptor tyrosine kinase ligand 6, is a member of the ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A2 and their Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A2 regulates the position-specific affinity of limb mesenchyme and is involved in cartilage pattern formation in the limb.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse EFNA2 (Catalog: RP01515) Protein at 2 μg/mL (100 μL/well) can bind Mouse EphA4 with a linear range of 4.88-129.3 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only