Recombinant Mouse Ephrin-A4/EFNA4 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP03100-10, RP03100-20, RP03100-50, RP03100-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Ephrin-A4/EFNA4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu26 - Gly176) of Mouse Ephrin-A4/EFNA4(Accession #NP_031936.2) fused with hFC at the C-Terminus.
Alternate Names: Efna4, Epl4, Eplg4, Lerk4
SWISS: O08542
GeneID: 13639
Species: Mouse
Purity: ≥ 90% as determined by reducing SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG
Endotoxin: < 0.01 EU/μg of the protein by LAL method.
Research Use Only