WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Ephrin-B2/EFNB2 Protein - RP01468

Recombinant Mouse Ephrin-B2/EFNB2 Protein - RP01468

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Ephrin-B2/EFNB2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01468-10, RP01468-20, RP01468-50, RP01468-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Ephrin-B2/EFNB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg29-Ala232) of mouse Ephrin-B2/EFNB2 (Accession #NP_034241.2) fused with a 6×His tag at the C-terminus.

Alternate Names: Epl5, ELF-2, Eplg5, Htk-L, Lerk5, LERK-5, NLERK-1, EFNB2

SWISS: P52800

GeneID: 13642

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse EFNB2 at 1 μg/mL (100 μL/well) can bind Mouse EPHB2 with a linear range of 0.01-1.3 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only