Recombinant Mouse Fc-gamma RIII/CD16 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP00761-10, RP00761-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Fc-gamma RIII/CD16 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala31-Thr215) of mouse Fc γ RIIIA/FCGR3/CD16 (Accession #P08508) fused with a 6×His tag at the C-terminus.
Alternate Names: Low affinity immunoglobulin gamma Fc region receptor III; Fcgr3; Fc gamma Receptor III; CD-antigen 16; CD16; FcRIII; IgG Fc receptor III
SWISS: P08508
GeneID: 14131
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Igsuperfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been dividedinto three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Eachgroup may be encoded by multiple genes and exist in different isoforms depending on species and cell type.Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting ofimmunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a varietyof myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligandbinding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependentcellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of typeI/IIa/III hypersensitivity.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only