WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IFN-alpha 2 Protein - RP01725

Recombinant Mouse IFN-alpha 2 Protein - RP01725

Regular price
$140.00
Regular price
Sale price
$140.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IFN-alpha 2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01725-10, RP01725-20, RP01725-50, RP01725-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-alpha 2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Cys24-Glu190) of mouse IFN-alpha 2 (Accession #) fused with no additional amino acid.

Alternate Names: IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2, interferon alpha-2, Interferon alpha 2 (IFN-α2) , IFN-alphaA, IFNA, IFNA2B, INFA2

SWISS: P01573

GeneID: 15965

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interferons (IFNs) are well-known cytokines that exert antiviral activity, antitumor activity, and immunomodulatory effects. Interferon tau (IFNT), a type I IFN similar to alpha IFNs (IFNA), is the pregnancy recognition signal produced by the ruminant conceptus. Among the IFN-α genes, a total of 28 different sequence variants have been described. The three principal subtypes of IFNα-2 are designated α-2a, α-2b, and α-2c. IFNα-2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant.

Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 51.80‑207.20 ng/mL, corresponding to a specific activity of 4.83×10^3 ~1.93×10^4 units/mg.

Source: Pichia

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only