WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IFN-alpha 6 Protein - RP00765

Recombinant Mouse IFN-alpha 6 Protein - RP00765

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IFN-alpha 6 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00765-10, RP00765-20, RP00765-50, RP00765-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-alpha 6 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 6(Accession #NP_996754.1) fused with His tag at the C-Terminus.

Alternate Names: Ifna6, If1ai11, Interferon 1ai11, Interferon alpha 6

SWISS: Q810G5

GeneID: 15969

Species: Mouse

Purity: ≥ 95% as determined by reducing SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Mature mouse IFNA6 consists of 166 aa and shares 60% aa identity with human IFNA6. The type I IFNs binds to the interferon alpha receptor (IFNAR) which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA6 displaying the superior efficacy controlling influenza virus infection and disease. Treatment with IFNA6 DNA 2 weeks post‐MCMV infection proved effective at inhibiting the development of chronic autoimmune myocarditis. IFNA6 is also able to reduce chronic cardiac inflammation. These findings suggest that immunomodulation of both antiviral and autoimmune responses by IFN DNA immunization may be an avenue for improved viral immunotherapy.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: CDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFGFPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLKACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLARLSEDE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only