Recombinant Mouse IL-12B/IL-12 p40 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01661-10, RP01661-20, RP01661-50, RP01661-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met23-Ser335) of mouse IL-12B (Accession #NP_001152896.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: p40; Il-12b; Il12p40; Il-12p40; IL12B
SWISS: P43432
GeneID: 16160
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Subunit beta of interleukin 12 (also known as natural killer cell stimulatory factor 2, or cytotoxic lymphocyte maturation factor 2, p40) (IL12B) is a subunit of human interleukin 12. IL12B/IL-12B is a cytokine that acts on T and natural killer cells and has a broad array of biological activities.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse IL12B (Catalog: RP01661) at 5 μg/mL (100 μL/well) can bind Human IL12RB1 with a linear range of 0.001-1.3 ng/mL.
Source: HEK293 cells
Tag: C-6his
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only