Recombinant Mouse IL-15RA/CD215 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01373-10, RP01373-20, RP01373-50, RP01373-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL15RA/CD215 (Accession #NP_032384.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: IL-15RA, CD215, AA690181, IL15RA
SWISS: Q60819-1
GeneID: 16169
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15.Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, orgamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cellspresents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide varietyof Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with themouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting fromalternative splicing events involving different exons.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human IL15 at 1 μg/mL (100 μL/well) can bind Mouse IL15RA with a linear range of 0.3-77 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only