Recombinant Mouse IL-17F Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01147-10, RP01147-20, RP01147-50, RP01147-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-17F Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala161) of mouse IL-17F (Accession #NP_665855.2) fused with a 6×His tag at the C-terminus.
Alternate Names: IL17F, IL24, ML-1, Interleukin-17F, IL17F
SWISS: Q7TNI7
GeneID: 257630
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Mouse IL-17F at 2 μg/mL (100 μL/well) can bind recombinant Mouse IL17RA with a linear range of 31.25-163 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only