WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-33 Protein - RP00618

Recombinant Mouse IL-33 Protein - RP00618

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-33 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00618-10, RP00618-20, RP00618-50, RP00618-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser109-Ile266) of mouse IL-33 (Accession #Q8BVZ5) fused with an initial Met at the N-terminus.

Alternate Names: Il33, Il1f11, NF-HEV, 9230117N10Rik, IL-33

SWISS: Q8BVZ5

GeneID: 77125

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Mouse Interleukin 33 (IL-33) is a proinflammatory cytokine which may also regulates gene transcription inproducer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines andacts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases andinduces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and alsoleads to severe pathological changes in mucosal organs.

Bio-Activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 0.0745-0.298 ng/mL, corresponding to a specific activity of 3.36×10^6 ~1.34×10^7 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.2 μM filtered solution of 20mM PB,150mM NaCl,pH7.4Contact us for customized product form or formulation.

Antigen Sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only