WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse LRG1 Protein - RP02863

Recombinant Mouse LRG1 Protein - RP02863

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse LRG1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02863-10, RP02863-20, RP02863-50, RP02863-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse LRG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu33-Leu342) of mouse LRG1 (Accession #NP_084072.1) fused with a 6×His tag at the C-terminus.

Alternate Names: LRG1, HMFT1766, LRG

SWISS: Q91XL1

GeneID: 76905

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only