Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01829-10, RP01829-20, RP01829-50, RP01829-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro2-Ala115) of mouse Macrophage migration inhibitory factor/MIF (Accession #NP_034928.1)
Alternate Names: GIF; DER6; Glif; Macrophage migration inhibitory factor; MIF
SWISS: P34884
GeneID: 17319
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12).
Source: E. coli
Tag: NO-Tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris 150mM NaCl pH8.0.
Antigen Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only